Structure of PDB 6fpx Chain E Binding Site BS01

Receptor Information
>6fpx Chain E (length=175) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPLNFSRASEHRNEKGERISMINPRVVLDENGISHRSRYFIMLCDNETAI
AHAKKTSIWAVKKDSSKRISDAYKKASVYFIFVAQQTYNALGYAQVVSDL
NSTELPFWSDSSHAGGVRIKWIKTCNLFSAEISEIVSHMDHGSEARDGME
MMYDEGSRLCTLINYAIMKRIGRDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fpx A low-complexity region in the YTH domain protein Mmi1 enhances RNA binding.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		N336 R338 R349 Y352 Y392 Y406 I435 K436 T437 Y466 S470 C473 N477 I480 R486 D487 R488
Binding residue
(residue number reindexed from 1)		N23 R25 R36 Y39 Y79 Y93 I122 K123 T124 Y153 S157 C160 N164 I167 R173 D174 R175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6fpx, PDBe:6fpx, PDBj:6fpx
PDBsum6fpx
PubMed29695507
UniProtO74958|MMI1_SCHPO RNA binding exosome specificity factor Mmi1 (Gene Name=mmi1)

[Back to BioLiP]