Structure of PDB 6f4h Chain E Binding Site BS01

Receptor Information
>6f4h Chain E (length=91) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQ
AFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVA
Ligand information
>6f4h Chain F (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccgcauugcaccucgcggcc
<<<<<<..........>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f4h Molecular principles underlying dual RNA specificity in the Drosophila SNF protein.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y10 N12 N13 E16 K19 T45 L46 K47 M48 R49 Q51 F53 K77 S84 K85 D87 S88 D89
Binding residue
(residue number reindexed from 1)		Y9 N11 N12 E15 K18 T44 L45 K46 M47 R48 Q50 F52 K76 S83 K84 D86 S87 D88
Binding affinityPDBbind-CN: Kd=34nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6f4h, PDBe:6f4h, PDBj:6f4h
PDBsum6f4h
PubMed29880797
UniProtP43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A (Gene Name=snf)

[Back to BioLiP]