Structure of PDB 6f4g Chain E Binding Site BS01

Receptor Information
>6f4g Chain E (length=90) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQA
FVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVA
Ligand information
>6f4g Chain F (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggccguauugcaguaccgcggcc
..<<<<<<...........>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f4g Molecular principles underlying dual RNA specificity in the Drosophila SNF protein.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y10 N12 N13 E16 K17 K20 K24 V41 A42 L43 K44 K47 M48 R49 Q51 F53 K77 S84 K85 D87 S88 D89
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K15 K18 K22 V39 A40 L41 K42 K45 M46 R47 Q49 F51 K75 S82 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6f4g, PDBe:6f4g, PDBj:6f4g
PDBsum6f4g
PubMed29880797
UniProtP43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A (Gene Name=snf)

[Back to BioLiP]