Structure of PDB 6dzt Chain E Binding Site BS01

Receptor Information
>6dzt Chain E (length=96) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>6dzt Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dzt Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 P43 V46 R49 R63 K64 L65 P66 R69
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 V9 R12 R26 K27 L28 P29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzt, PDBe:6dzt, PDBj:6dzt
PDBsum6dzt
PubMed31127102
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]