Structure of PDB 6c4u Chain E Binding Site BS01

Receptor Information
>6c4u Chain E (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIVFRVISTTGQIPIRDFSADISQVLKEKRSIKKVWTFGRNPACDYHLGN
ILPVSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSYQLLSQGDEI
TVRTDPTGTILSLVIFINDKFKQSLEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c4u Generating a recombinant phosphothreonine-binding domain for a phosphopeptide of the human transcription factor, c-Myc.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R70 N71 L82 P83 S85 N86 T106 N107 R133
Binding residue
(residue number reindexed from 1)		R40 N41 L52 P53 S55 N56 T76 N77 R103
Enzymatic activity
Enzyme Commision number 2.7.12.1: dual-specificity kinase.
External links
PDB RCSB:6c4u, PDBe:6c4u, PDBj:6c4u
PDBsum6c4u
PubMed29763736
UniProtP22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 (Gene Name=RAD53)

[Back to BioLiP]