Structure of PDB 6c48 Chain E Binding Site BS01

Receptor Information
>6c48 Chain E (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILE
KPKK
Ligand information
>6c48 Chain F (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAWKTVACGGTRDQLFMQEKARQLLGRL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c48 Structural mechanism of Myb-MuvB assembly.
Resolution2.32 Å
Binding residue
(original residue number in PDB)		Y92 G95 L96 E98 S99 M102 T103 K106 L111
Binding residue
(residue number reindexed from 1)		Y30 G33 L34 E36 S37 M40 T41 K44 L49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0070176 DRM complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c48, PDBe:6c48, PDBj:6c48
PDBsum6c48
PubMed30224471
UniProtQ52LA3|LIN52_HUMAN Protein lin-52 homolog (Gene Name=LIN52)

[Back to BioLiP]