Structure of PDB 6c0w Chain E Binding Site BS01

Receptor Information
>6c0w Chain E (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLAL
QEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGL
Ligand information
>6c0w Chain I (length=139) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagaatccggtgccgaggccgctcaattggtcgtagacagctctagcacc
gcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggat
tactccctagtctccaggcacgtgtcagatatatacatc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0w Decoding the centromeric nucleosome through CENP-N.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		K49 K64 L65
Binding residue
(residue number reindexed from 1)		K5 K20 L21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0000281 mitotic cytokinesis
GO:0034080 CENP-A containing chromatin assembly
GO:0051301 cell division
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
GO:0071459 protein localization to chromosome, centromeric region
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005829 cytosol
GO:0043505 CENP-A containing nucleosome
GO:0061638 CENP-A containing chromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c0w, PDBe:6c0w, PDBj:6c0w
PDBsum6c0w
PubMed29280735
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]