Structure of PDB 6bzu Chain E Binding Site BS01

Receptor Information
>6bzu Chain E (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLSESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGY
ISYSGGNYYNPSLRSRISITRDTSKNHYYLQLNSVTTEDTATYYCARLSD
SLYAMDCWGQGTSVTVSSASTKGPSVFPCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTYICNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bzu Immunogenetic and structural analysis of a class of HCV broadly neutralizing antibodies and their precursors.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y33 Y50 Y58 Y100
Binding residue
(residue number reindexed from 1)		Y33 Y50 Y58 Y103
External links