Structure of PDB 6bbo Chain E Binding Site BS01

Receptor Information

>6bbo Chain E (length=180) Species: 9606 (Homo sapiens)

LLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKE
CHAAICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHL
NLRIFASRLYYHWCKPQQDGLRLLCGSQVPVEVMGFPEFADCWENFVDHE
KPLSFNPYKMLEELDKNSRAIKRRLDRIKQ

Ligand information

>6bbo Chain F (length=8)

uaaaaaaa

........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6bbo The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
• Resolution: 3.428 Å
• Binding residue (original residue number in PDB): K16 R17 R18 W115 R179
• Binding residue (residue number reindexed from 1): K14 R15 R16 W113 R177

Enzymatic activity

• Enzyme Commision number: 3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0010526 retrotransposon silencing
• GO:0016554 cytidine to uridine editing
• GO:0044355 clearance of foreign intracellular DNA
• GO:0044828 negative regulation by host of viral genome replication
• GO:0045087 innate immune response
• GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
• GO:0051607 defense response to virus
• GO:0070383 DNA cytosine deamination

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6bbo, PDBe:6bbo, PDBj:6bbo
• PDBsum: 6bbo
• PubMed: 29290613
• UniProt: Q6NTF7|ABC3H_HUMAN DNA dC->dU-editing enzyme APOBEC-3H (Gene Name=APOBEC3H)