Structure of PDB 6ati Chain E Binding Site BS01

Receptor Information

>6ati Chain E (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVHPKVTV
YPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAT

Ligand information

>6ati Chain F (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GVYATtSSAVRLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ati Molecular basis for increased susceptibility of Indigenous North Americans to seropositive rheumatoid arthritis.
Resolution	1.98 Å
Binding residue (original residue number in PDB)	E9 F26 Y30 N37 D57 Y60 W61 Q70 R71 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	E8 F25 Y29 N36 D56 Y59 W60 Q69 R70 Y77 H80 N81 V84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ati, PDBe:6ati, PDBj:6ati
PDBsum	6ati
PubMed	28801345
UniProt	A0A0A1I7H6

[Back to BioLiP]