Structure of PDB 6atf Chain E Binding Site BS01

Receptor Information
>6atf Chain E (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVHPKVTV
YPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6atf Molecular basis for increased susceptibility of Indigenous North Americans to seropositive rheumatoid arthritis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
E9 S11 T12 S13 E28 Y30 N37 D57 Y60 W61 R71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
E8 S10 T11 S12 E27 Y29 N36 D56 Y59 W60 R70 Y77 H80 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6atf, PDBe:6atf, PDBj:6atf
PDBsum6atf
PubMed28801345
UniProtA0A0A1I7H6

[Back to BioLiP]