Structure of PDB 5zmd Chain E Binding Site BS01

Receptor Information
>5zmd Chain E (length=395) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIK
GKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKKHTEAEIAAACETFL
KLNDYLQIETIQALEELAAVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYF
GMGKMAVSWHHDENLVDRSAVAVYSYSCEDIWHVGFKISWDIETPGLAIP
LHQGDCYFMLDDLNATHKHCVLAGSQPRFSSTHRVAECSTGTLDYILQRC
QLALQNVDVSLKSFEPAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDW
WCQPMAQLEALWKKMEGVTNAVLHEVQRNEILTAILASLTARQNLRREWH
ARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zmd Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		I85 K86 K88 L90 P93 R96 Y108 L109 N110 K216 M226 V228 S229 H231 E234 R459 I460
Binding residue
(residue number reindexed from 1)		I49 K50 K52 L54 P57 R60 Y72 L73 N74 K145 M155 V157 S158 H160 E163 R356 I357
Binding affinityPDBbind-CN: Kd=3.69uM
Enzymatic activity
Enzyme Commision number 1.14.11.-
1.14.11.53: mRNA N(6)-methyladenine demethylase.
Gene Ontology
Molecular Function
GO:0008198 ferrous iron binding
GO:0016706 2-oxoglutarate-dependent dioxygenase activity
GO:0016740 transferase activity
GO:0035515 oxidative RNA demethylase activity
GO:0035516 broad specificity oxidative DNA demethylase activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
GO:1990931 mRNA N6-methyladenosine dioxygenase activity
GO:1990984 tRNA demethylase activity
Biological Process
GO:0001659 temperature homeostasis
GO:0006307 DNA alkylation repair
GO:0010883 regulation of lipid storage
GO:0016180 snRNA processing
GO:0040014 regulation of multicellular organism growth
GO:0042245 RNA repair
GO:0044065 regulation of respiratory system process
GO:0060612 adipose tissue development
GO:0061157 mRNA destabilization
GO:0070350 regulation of white fat cell proliferation
GO:0090335 regulation of brown fat cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016607 nuclear speck
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zmd, PDBe:5zmd, PDBj:5zmd
PDBsum5zmd
PubMed30718435
UniProtQ9C0B1|FTO_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO (Gene Name=FTO)

[Back to BioLiP]