Structure of PDB 5zjt Chain E Binding Site BS01

Receptor Information
>5zjt Chain E (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR
RMKNKKNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zjt Intrinsic DNA Shape Accounts for Affinity Differences between Hox-Cofactor Binding Sites.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		L32 K36
Binding residue
(residue number reindexed from 1)		L12 K16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5zjt, PDBe:5zjt, PDBj:5zjt
PDBsum5zjt
PubMed30157419
UniProtP09087|ABDB_DROME Homeobox protein abdominal-B (Gene Name=Abd-B)

[Back to BioLiP]