Structure of PDB 5zbx Chain E Binding Site BS01

Receptor Information
>5zbx Chain E (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREICQDFTRGVDF
NWQAQALLALQEAAEAFLVHLFEDAYLLTLHAKRVTIMPKDIQLARRIRG
E
Ligand information
>5zbx Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zbx The CENP-A centromere targeting domain facilitates H4K20 monomethylation in the nucleosome by structural polymorphism.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 G44 V46 R49 R63 K64 L65 R69
Binding residue
(residue number reindexed from 1)		H5 R6 Y7 G10 V12 R15 R29 K30 L31 R35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5zbx, PDBe:5zbx, PDBj:5zbx
PDBsum5zbx
PubMed30718488
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA);
P68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]