Structure of PDB 5z3g Chain E Binding Site BS01

Receptor Information

>5z3g Chain E (length=133) Species: 559292 (Saccharomyces cerevisiae S288C)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>5z3g Chain C (length=65)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<.....>>>>>.....<<<<...<<<......>>>..>>>
>..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
• Resolution: 3.65 Å
• Binding residue (original residue number in PDB): Y94 R97 H100 R124 N125 K126 T128 N130 R132 H133 Y134 F136 L157 M158 H160 E174 K175 L176 Y177 Y179 I189 K203
• Binding residue (residue number reindexed from 1): Y7 R10 H13 R37 N38 K39 T41 N43 R45 H46 Y47 F49 L70 M71 H73 E87 K88 L89 Y90 Y92 I102 K116

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
• PDBsum: 5z3g
• PubMed: 29557065
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)