Structure of PDB 5y53 Chain E Binding Site BS01

Receptor Information
>5y53 Chain E (length=131) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPRTVEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNES
WEVNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSF
YFGARLNRNERKRLFSLINDLPTLFDVVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y53 Structural Analysis of the Arabidopsis AL2-PAL and PRC1 Complex Provides Mechanistic Insight into Active-to-Repressive Chromatin State Switch
Resolution1.598 Å
Binding residue
(original residue number in PDB)		P44 E47 N48 L77 F81 A82 G85
Binding residue
(residue number reindexed from 1)		P36 E39 N40 L69 F73 A74 G77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042393 histone binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5y53, PDBe:5y53, PDBj:5y53
PDBsum5y53
PubMed30176245
UniProtQ9SRM4|ALFL2_ARATH PHD finger protein ALFIN-LIKE 2 (Gene Name=AL2)

[Back to BioLiP]