Structure of PDB 5xrz Chain E Binding Site BS01

Receptor Information
>5xrz Chain E (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINL
ANEMFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDV
GYGVSEGLASKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC
Ligand information
>5xrz Chain L (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttttttttttttttttttcccttttttttttttttttttt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xrz Structural Basis of Homology-Directed DNA Repair Mediated by RAD52
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R55 V63 Y65 K144 T148 D149 K152 R153 R156 L167
Binding residue
(residue number reindexed from 1)		R31 V39 Y41 K120 T124 D125 K128 R129 R132 L143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0000730 DNA recombinase assembly
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0045002 double-strand break repair via single-strand annealing
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xrz, PDBe:5xrz, PDBj:5xrz
PDBsum5xrz
PubMed30428330
UniProtP43351|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]