Structure of PDB 5u91 Chain E Binding Site BS01

Receptor Information
>5u91 Chain E (length=326) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALPADDEVRKNLMDVFRDRPAFSEHTWEMLLSVCRSWAAWCKLNNRKWFP
AEPEDVRDYLLHLQARGLAVKTIQQHLCRLNMLHRRSGLPRPSDSNAVSL
VMRRIRKENVDAGERTKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLG
VAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSL
GVTKLVERWISVSGVADDPNNYLFCRVRRYGVAAPSATSQLSTYALQRIF
EATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGW
TTVNSVMNFIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u91 Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.
Resolution3.104 Å
Binding residue
(original residue number in PDB)
F37 S38 T41 R94 R100 I174 A175 K201 R243 Y245 V247 Y259 Q262 R282 Y283 S287 G288 H289
Binding residue
(residue number reindexed from 1)
F22 S23 T26 R79 R85 I159 A160 K186 R228 Y230 V232 Y244 Q247 R267 Y268 S272 G273 H274
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Nov 17 02:56:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5u91', asym_id = 'E', bs = 'BS01', title = 'Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5u91', asym_id='E', bs='BS01', title='Crystal structure of an engineered, HIV-specific recombinase for removal of integrated proviral DNA.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677,0006310,0015074', uniprot = '', pdbid = '5u91', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0006310,0015074', uniprot='', pdbid='5u91', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>