Structure of PDB 5t5o Chain E Binding Site BS01

Receptor Information

>5t5o Chain E (length=229) Species: 413686 (Bauhinia forficata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SELSFNYPNFQSVEDITFQGGASPRNETLQLTPTDSNGIPIRQRAGHAVY
SQPFQLRDTSFYTTFTFVIRTTSNSPADGFAIFIAPPDFPVKRYGGYLGL
FEPNTATNTSANKVVAVEFDTWVNTEWKEPRYRHIGIDVNSIVSVRVTRW
QDKDVFSRSIATAHVGYDGISKILTAFVTYPDGGNYVLSHVVDLAEIFPG
DVRIGFSGATGQYETQYIHSWSFSSTSTN

Ligand information

>5t5o Chain e (length=5) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GVTSA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5t5o Structural analysis and unique molecular recognition properties of a Bauhinia forficata lectin that inhibits cancer cell growth.
Resolution	2.75 Å
Binding residue (original residue number in PDB)	T125 E126
Binding residue (residue number reindexed from 1)	T125 E126

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5t5o, PDBe:5t5o, PDBj:5t5o
PDBsum	5t5o
PubMed	27973758
UniProt	P86993\|LECT_BAUFO Lectin

[Back to BioLiP]