Structure of PDB 5o9z Chain E Binding Site BS01

Receptor Information
>5o9z Chain E (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGT
EAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDI
SQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGG
PKAQKKFKRLMLHRIKAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENM
AREHFKKHGAEHYWDLALS
Ligand information
>5o9z Chain 6 (length=90) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacauucgugaagcgu
<<<<<.<<....>>>>>>>...............................
........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o9z Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		K475 N480 N515 R518 K519 P554 F558 A562
Binding residue
(residue number reindexed from 1)		K38 N43 N78 R81 K82 P117 F121 A125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o9z, PDBe:5o9z, PDBj:5o9z
PDBsum5o9z
PubMed28781166
UniProtO43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)

[Back to BioLiP]