Structure of PDB 5o4y Chain E Binding Site BS01

Receptor Information
>5o4y Chain E (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAAYA
Ligand information
>5o4y Chain A (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FANPHLSWSWKKRCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o4y Bioactive Macrocyclic Inhibitors of the PD-1/PD-L1 Immune Checkpoint.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y56 N63 Q66 V68 D73 V76 R113 M115 Y123
Binding residue
(residue number reindexed from 1)		Y39 N46 Q49 V51 D56 V59 R96 M98 Y106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5o4y, PDBe:5o4y, PDBj:5o4y
PDBsum5o4y
PubMed28881104
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]