Structure of PDB 5nwk Chain E Binding Site BS01

Receptor Information
>5nwk Chain E (length=238) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAPTAREENVYMAKLAEQAERYEEMVEFMEKVSNSLGSEELTVEERNLLS
VAYKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKI
CDGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAE
STLTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAK
QAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nwk Fusicoccin Activates KAT1 Channels by Stabilizing Their Interaction with 14-3-3 Proteins.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R63 K129 R136 Y137 N182 Y188 E189 N233 W237
Binding residue
(residue number reindexed from 1)		R61 K127 R134 Y135 N180 Y186 E187 N231 W235
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007165 signal transduction
GO:0008104 protein localization
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nwk, PDBe:5nwk, PDBj:5nwk
PDBsum5nwk
PubMed28970335
UniProtP93343|1433C_TOBAC 14-3-3-like protein C

[Back to BioLiP]