Structure of PDB 5nl1 Chain E Binding Site BS01

Receptor Information
>5nl1 Chain E (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKM
DESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTE
MSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQP
Ligand information
>5nl1 Chain H (length=23) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RETIFEASKKVTNSLSNLISLIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nl1 Shigella IpaA Binding to Talin Stimulates Filopodial Capture and Cell Adhesion.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
A494 S501 Q504
Binding residue
(residue number reindexed from 1)
A8 S15 Q18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
Cellular Component
GO:0001726 ruffle
GO:0005925 focal adhesion

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5nl1, PDBe:5nl1, PDBj:5nl1
PDBsum5nl1
PubMed30673614
UniProtP26039|TLN1_MOUSE Talin-1 (Gene Name=Tln1)

[Back to BioLiP]