Structure of PDB 5nif Chain E Binding Site BS01

Receptor Information

>5nif Chain E (length=236) Species: 559292 (Saccharomyces cerevisiae S288C)

YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSP
LLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDI
NVESLTQSVCDLALRFGELMSRPFGVALLIAGHDADDGYQLFHAEPSGTF
YRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDE
NNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE

Ligand information

>5nif Chain 4 (length=6) Species: 4932 (Saccharomyces cerevisiae)

WRSYYA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5nif Crystal structure of a low molecular weight activator Blm-pep with yeast 20S proteasome - insights into the enzyme activation mechanism.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): G19 R20 E25 E159
• Binding residue (residue number reindexed from 1): G12 R13 E18 E145

Enzymatic activity

• Catalytic site (original residue number in PDB): E51 R53 K66 G80 S174
• Catalytic site (residue number reindexed from 1): E44 R46 K59 G73 S160
• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding

Biological Process

• GO:0006511 ubiquitin-dependent protein catabolic process
• GO:0010499 proteasomal ubiquitin-independent protein catabolic process
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005839 proteasome core complex
• GO:0019773 proteasome core complex, alpha-subunit complex
• GO:0034515 proteasome storage granule

External links

• PDB: RCSB:5nif, PDBe:5nif, PDBj:5nif
• PDBsum: 5nif
• PubMed: 28733623
• UniProt: P32379|PSA5_YEAST Proteasome subunit alpha type-5 (Gene Name=PUP2)