Structure of PDB 5msm Chain E Binding Site BS01

Receptor Information
>5msm Chain E (length=124) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVDIDASQWQKLTTVITPLGMMMLEIQGELELPKDFASLARRDSPNEGR
FSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPMGIMHFNS
KDNKVELVDVMKYKVIFKDRPLPI
Ligand information
>5msm Chain F (length=26) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKIWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5msm Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		P2 Q36 G37 E38 E40 V84 G85 Q88 F106 N107 S108 N111 K112 K126 D127 R128 P129
Binding residue
(residue number reindexed from 1)		P1 Q28 G29 E30 E32 V76 G77 Q80 F98 N99 S100 N103 K104 K118 D119 R120 P121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5msm, PDBe:5msm, PDBj:5msm
PDBsum5msm
PubMed28188145
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]