Structure of PDB 5l6l Chain E Binding Site BS01

Receptor Information
>5l6l Chain E (length=64) Species: 190650 (Caulobacter vibrioides CB15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHARATGKTFRSGNSEAVRLPRDLAFGADVELTLIRSGDVLTIYPSKGSI
ADLVATLNQMPRPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l6l Toxin inhibition in C. crescentus VapBC1 is mediated by a flexible pseudo-palindromic protein motif and modulated by DNA binding.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		G12 N13 S14
Binding residue
(residue number reindexed from 1)		G13 N14 S15
Enzymatic activity
Enzyme Commision number ?
External links