Structure of PDB 5l2l Chain E Binding Site BS01

Receptor Information
>5l2l Chain E (length=72) Species: 1294386 (Saccharomyces cerevisiae YJM1574) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDC
RFGVNCKNIYCLFRHPPGRVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l2l Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		E413 C415 N423 R425 Y428
Binding residue
(residue number reindexed from 1)		E5 C7 N15 R17 Y20
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5l2l, PDBe:5l2l, PDBj:5l2l
PDBsum5l2l
PubMed28180315
UniProtP32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 (Gene Name=NAB2)

[Back to BioLiP]