Structure of PDB 5k5l Chain E Binding Site BS01

Receptor Information
>5k5l Chain E (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQH
QKSHKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5l Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.125 Å
Binding residue
(original residue number in PDB)
I446 R448 D451 H455 Q459 R479
Binding residue
(residue number reindexed from 1)
I11 R13 D16 H20 Q24 R44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5k5l, PDBe:5k5l, PDBj:5k5l
PDBsum5k5l
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]