Structure of PDB 5jme Chain E Binding Site BS01

Receptor Information

>5jme Chain E (length=208) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DDDKLHSQANLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNE
VDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPV
QVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVY
SGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVN
LVVKFRER

Ligand information

>5jme Chain G (length=16) Species: 330676 (Conus pergrandis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GCCSHPACSVNHPELC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jme Crystal structure of acetylcholine binding protein (AChBP) from Aplysia Californica in complex with alpha-conotoxin PeIA
Resolution	2.336 Å
Binding residue (original residue number in PDB)	Q57 M116 I118 S166 S167
Binding residue (residue number reindexed from 1)	Q58 M117 I119 S167 S168

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005230	extracellular ligand-gated monoatomic ion channel activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0034220	monoatomic ion transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5jme, PDBe:5jme, PDBj:5jme
PDBsum	5jme
PubMed
UniProt	Q8WSF8

[Back to BioLiP]