Structure of PDB 5ivx Chain E Binding Site BS01

Receptor Information
>5ivx Chain E (length=194) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISIL
SVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNSK
LIWGLGTSLVVNPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKT
MESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ivx An allosteric site in the T-cell receptor C beta domain plays a critical signalling role.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S96 F97 D99 N100
Binding residue
(residue number reindexed from 1)		S94 F95 D97 N98
External links