Structure of PDB 5gin Chain E Binding Site BS01

Receptor Information
>5gin Chain E (length=227) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREW
NAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKA
YGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDI
AQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLE
NSNFETIQIINLDPYDKDHAIVLSKYK
Ligand information
>5gin Chain G (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagucuugugaugaaacacucauggucugaaga
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gin Box C/D guide RNAs recognize a maximum of 10 nt of substrates
Resolution3.308 Å
Binding residue
(original residue number in PDB)		S110 R112 A155 P157 R184 S185 D187 V188
Binding residue
(residue number reindexed from 1)		S106 R108 A151 P153 R180 S181 D183 V184
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0016740 transferase activity
GO:1990259 histone H2AQ104 methyltransferase activity
Biological Process
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006338 chromatin remodeling
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
Cellular Component
GO:0031428 box C/D methylation guide snoRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gin, PDBe:5gin, PDBj:5gin
PDBsum5gin
PubMed27625427
UniProtP58032|FLPA_SACS2 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)

[Back to BioLiP]