Structure of PDB 5ft1 Chain E Binding Site BS01

Receptor Information
>5ft1 Chain E (length=245) Species: 169683 (Phikzvirus phiKZ) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FNITWEEQLQALSKLDGLHHPHKLEDISVHWFNPVDISVFVTCATMSSHN
THYFKPQSSPDDAMVREYVLSRIIADNLKYVDNLYLAAGAVICGNDEYIS
DGNVVGHIADGILPVIEFMPGVHVDDISDKLIKSSSYQGIFKTDNLEEFE
FLVDKKNANNVKELILAYTDYFANKLAFKDPAEPAVEMYQFIDRTEVYFS
FEGCHPDVEEVLFTIKIVRYNQPLNSMQVFLKNPLLSHIRTVVRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ft1 Structural elucidation of a novel mechanism for the bacteriophage-based inhibition of the RNA degradosome.
Resolution2.75 Å
Binding residue
(original residue number in PDB)
D138 F190 E195 E214 E222
Binding residue
(residue number reindexed from 1)
D126 F178 E183 E202 E210
Enzymatic activity
Enzyme Commision number ?
External links