Structure of PDB 5flv Chain E Binding Site BS01

Receptor Information
>5flv Chain E (length=227) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYK
SKRQRQIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPK
TKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAH
WMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKASTHVFPETA
FIAVTSYQNHKITQLKIENNPFAKGFR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5flv Complex Interdependence Regulates Heterotypic Transcription Factor Distribution and Coordinates Cardiogenesis.
Resolution3.005 Å
Binding residue
(original residue number in PDB)		V142 F144 Q180 I183 W184 N187 N1162 S1175 T1215 P1231 K1234 G1235
Binding residue
(residue number reindexed from 1)		V1 F3 Q39 I42 W43 N46 N165 S178 T205 P221 K224 G225
Binding affinityPDBbind-CN: Kd~50nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5flv, PDBe:5flv, PDBj:5flv
PDBsum5flv
PubMed26875865
UniProtP42582;
P70326

[Back to BioLiP]