Structure of PDB 5fgc Chain E Binding Site BS01

Receptor Information
>5fgc Chain E (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLAQPGESLRLSCAASGFNFYTYAMTWVRQAPGKGLEWVSA
SSSTDGTTYYADSVKGRFTISRDNSKNILYLQMNSLKAEDTATYYCARAV
VFTDSSAYYYSKYFDYWSQGTLVTVSSASTKGPSVFPLAPSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKAEPKSC
Ligand information
>5fgc Chain A (length=9) Species: 11108 (Hepatitis C virus (isolate H)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NTNGSWHIN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fgc Antibody Response to Hypervariable Region 1 Interferes with Broadly Neutralizing Antibodies to Hepatitis C Virus.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		T31 A33 W47 A50 S52 S53 Y59 V101 F102 T103 Y110 K112
Binding residue
(residue number reindexed from 1)		T31 A33 W47 A50 S52 S53 Y59 V101 F102 T103 Y110 K112
External links