Structure of PDB 5eel Chain E Binding Site BS01

Receptor Information
>5eel Chain E (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVK
HYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCT
RV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eel Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
Resolution2.47 Å
Binding residue
(original residue number in PDB)
H433 I436 E440 R529 V530
Binding residue
(residue number reindexed from 1)
H5 I8 E12 R101 V102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5eel, PDBe:5eel, PDBj:5eel
PDBsum5eel
PubMed27257138
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]