Structure of PDB 5dws Chain E Binding Site BS01

Receptor Information
>5dws Chain E (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dws Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
Resolution1.65 Å
Binding residue
(original residue number in PDB)
R447 Y455 V457 H459 R462 T464 Q465 W466
Binding residue
(residue number reindexed from 1)
R10 Y18 V20 H22 R25 T27 Q28 W29
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:5dws, PDBe:5dws, PDBj:5dws
PDBsum5dws
PubMed
UniProtQ96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog (Gene Name=ITCH)

[Back to BioLiP]