Structure of PDB 5dqt Chain E Binding Site BS01

Receptor Information
>5dqt Chain E (length=93) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGL
AEEGNVVMAWATNTETGFEFQTFGLNRRTPVDLDGLRLVSFLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dqt Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E9 N10 A28
Binding residue
(residue number reindexed from 1)		E9 N10 A28
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5dqt, PDBe:5dqt, PDBj:5dqt
PDBsum5dqt
PubMed26478180
UniProtP45956|CAS2_ECOLI CRISPR-associated endoribonuclease Cas2 (Gene Name=ygbF)

[Back to BioLiP]