Structure of PDB 5dmg Chain E Binding Site BS01

Receptor Information
>5dmg Chain E (length=198) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGRLVTPGTPLTLTCTVSGFSLSSNAINWVRQAPGKGLEWIGYI
AVSGNTYYASWAKGRFTISKASTTVDLKMTSPTAEDTGTYFCGKSNIWGP
GTLVTVSLASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGV
HTFPAVLQSSGLYSLSSVVTVPSSSLQTYICNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dmg VH-VL orientation prediction for antibody humanization candidate selection: A case study.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
A197 N199 Y251 A253 S288 K332 S351 W401
Binding residue
(residue number reindexed from 1)
A32 N34 Y49 A51 S53 K94 S95 W98
External links