Structure of PDB 5d5x Chain E Binding Site BS01

Receptor Information
>5d5x Chain E (length=98) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDFVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSN
FASFVRQLNKYDFHKVRHNSPYGRDAWEFKHPEFRADRKDNLDNIRRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d5x Structure of human heat-shock transcription factor 1 in complex with DNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R96 N99 H104 K105 R107 K143
Binding residue
(residue number reindexed from 1)		R56 N59 H64 K65 R67 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d5x, PDBe:5d5x, PDBj:5d5x
PDBsum5d5x
PubMed26727489
UniProtG0SB31|SKN7_CHATD Transcription factor SKN7 (Gene Name=SKN7)

[Back to BioLiP]