Structure of PDB 5d2m Chain E Binding Site BS01

Receptor Information
>5d2m Chain E (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFD
GQPINETDTPAQLEMEDEDTIDVFQQQTGG
Ligand information
>5d2m Chain G (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DIQFVSEGPLRPVLEYIDLVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d2m Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		G27 S28 V29 Q31 F32 K33 K42 L43 R50
Binding residue
(residue number reindexed from 1)		G14 S15 V16 Q18 F19 K20 K29 L30 R37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5d2m, PDBe:5d2m, PDBj:5d2m
PDBsum5d2m
PubMed26524494
UniProtP61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 (Gene Name=SUMO2)

[Back to BioLiP]