Structure of PDB 4yr6 Chain E Binding Site BS01

Receptor Information
>4yr6 Chain E (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIQMTQSPASLSASVGETVTITCRASGNIYNYLAWYQQKQGKSPQLLVYN
AKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYFCQHFWDTPWTFGG
GTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKI
DGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yr6 Structural basis for the specific inhibition of glycoprotein Ib alpha shedding by an inhibitory antibody.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		Y30 Y32 F91 W92 D93 T94 W96
Binding residue
(residue number reindexed from 1)		Y30 Y32 F91 W92 D93 T94 W96
External links