Structure of PDB 4yg7 Chain E Binding Site BS01

Receptor Information
>4yg7 Chain E (length=69) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTT
LTTFFKILQSLELSMTLCD
Ligand information
>4yg7 Chain R (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttatccccttaaggggatatatatatatatatccccttaaggggataa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yg7 HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
Resolution3.77 Å
Binding residue
(original residue number in PDB)		I37 K38 T41 N51 T53
Binding residue
(residue number reindexed from 1)		I34 K35 T38 N48 T50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4yg7, PDBe:4yg7, PDBj:4yg7
PDBsum4yg7
PubMed26222023
UniProtP23873|HIPB_ECOLI Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]