Structure of PDB 4xgr Chain E Binding Site BS01

Receptor Information
>4xgr Chain E (length=128) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARF
GEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKAGLNYGDCFSY
GLAKISGQPLLFKGEDFQHTDIATVALP
Ligand information
>4xgr Chain H (length=24) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DELAAIRHRCAALPVVDNRSAEAI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xgr Structural and functional studies of the Mycobacterium tuberculosis VapBC30 toxin-antitoxin system: implications for the design of novel antimicrobial peptides
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y83 K88 N96
Binding residue
(residue number reindexed from 1)		Y84 K89 N93
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0045926 negative regulation of growth

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xgr, PDBe:4xgr, PDBj:4xgr
PDBsum4xgr
PubMed26150422
UniProtP9WF77|VPC30_MYCTU Ribonuclease VapC30 (Gene Name=vapC30)

[Back to BioLiP]