Structure of PDB 4wym Chain E Binding Site BS01

Receptor Information

>4wym Chain E (length=215) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPIAPGQMREPRGSDIA
GTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQ
GPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKAL
GPGATLEEMMTACQG

Ligand information

>4wym Chain Q (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wym Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	N53 N57 Q67 K70 N74 T107
Binding residue (residue number reindexed from 1)	N53 N57 Q67 K70 N74 T102

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:4wym, PDBe:4wym, PDBj:4wym
PDBsum	4wym
PubMed	25518861
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]