Structure of PDB 4wfd Chain E Binding Site BS01

Receptor Information
>4wfd Chain E (length=101) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEDIEKIKPYVRSFSKALDELKPEIEKLTSKSLDEQLLLLSDERAKLELI
NRYAYVLSSLMFANMKVLGVKDMSPILGELKRVKSYMDKAKQYDNRITKS
N
Ligand information
>4wfd Chain F (length=8) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLFDVFEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wfd The exosome-binding factors Rrp6 and Rrp47 form a composite surface for recruiting the Mtr4 helicase.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y55 S59 F62 L80 K84
Binding residue
(residue number reindexed from 1)		Y55 S59 F62 L80 K84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4wfd, PDBe:4wfd, PDBj:4wfd
PDBsum4wfd
PubMed25319414
UniProtP38801|LRP1_YEAST Exosome complex protein LRP1 (Gene Name=LRP1)

[Back to BioLiP]