Structure of PDB 4wan Chain E Binding Site BS01

Receptor Information
>4wan Chain E (length=122) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSV
KEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSP
EGQNDLKRGQLRELAELNGTLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wan Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		G166 L169 G170 P171 R172 G173 L176 R177 A188 I189 R190 S194 K196 P205 G247 N249 K252 Q255 L256 R257 L259 A260 R267
Binding residue
(residue number reindexed from 1)		G21 L24 G25 P26 R27 G28 L31 R32 A43 I44 R45 S49 K51 P60 G102 N104 K107 Q110 L111 R112 L114 A115 R122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4wan, PDBe:4wan, PDBj:4wan
PDBsum4wan
PubMed25587180
UniProtQ12186|BBP_YEAST Branchpoint-bridging protein (Gene Name=MSL5)

[Back to BioLiP]