Structure of PDB 4tzo Chain E Binding Site BS01

Receptor Information
>4tzo Chain E (length=236) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFT
KNYITEKLKCMTLCFRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNNE
GDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVYEGGDS
VRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFED
SSTFYTLPDDIQSATIGHLRPGCHAANMECWSMLMS
Ligand information
>4tzo Chain F (length=14) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARDSPYGLSQGITK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tzo The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		L60 K145 E192 F193 T194 A195 N196 F197 R198 L199 E200 Y201 S207 F209 F214 E215 D216 S217 S218 T219 F220
Binding residue
(residue number reindexed from 1)		L44 K129 E176 F177 T178 A179 N180 F181 R182 L183 E184 Y185 S191 F193 F198 E199 D200 S201 S202 T203 F204
Enzymatic activity
Enzyme Commision number ?
External links