Structure of PDB 4s0r Chain E Binding Site BS01

Receptor Information
>4s0r Chain E (length=443) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKYTREDIEKLVKEENVKYIRLQFTDILGTIKNVEIPVSQLGKALDNKVM
FDGSSIEGFVRIEESDMYLYPDLNTFVIFPWTAEKGKVARFICDIYNPDG
TPFEGDPRNNLKRILKEMEDLGFSDFNLGPEPEFFLFKLDEKGEPTLELN
DKGGYFDLAPTDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKY
AGAVRSCDDIQTFKLVVKTIARKHGLHATFMPKPLFGVNGSGMHCNLSLF
KNGVNAFFDENADLQLSETAKHFIAGIVKHATSFTAVTNPTVNSYKRLVP
GYEAPCYVAWSAQNRSPLIRIPASRGISTRVEVRSVDPAANPYLALSVLL
AAGLDGIKNKLEAPAPIDRNIYVMSKEERMENGIVDLPATLAEALEEFKS
NEVMVKALGEHLFEHFIEAKEIEWDMFRTQVHPWEREQYMSQY
Ligand information
>4s0r Chain R (length=15) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KMLEGQNAHFRYKNR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4s0r Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F60 R62 I423 M427
Binding residue
(residue number reindexed from 1)		F59 R61 I422 M426
Enzymatic activity
Catalytic site (original residue number in PDB) D53 E132 E134 E189 E196 H245 R316 E333 R335
Catalytic site (residue number reindexed from 1) D52 E131 E133 E188 E195 H244 R315 E332 R334
Enzyme Commision number 6.3.1.2: glutamine synthetase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003824 catalytic activity
GO:0004356 glutamine synthetase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016595 glutamate binding
GO:0016874 ligase activity
GO:0046872 metal ion binding
GO:0070406 glutamine binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0006542 glutamine biosynthetic process
GO:0043562 cellular response to nitrogen levels
GO:0045892 negative regulation of DNA-templated transcription
GO:0090295 nitrogen catabolite repression of transcription
GO:1904797 negative regulation of core promoter binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4s0r, PDBe:4s0r, PDBj:4s0r
PDBsum4s0r
PubMed25691471
UniProtP12425|GLN1A_BACSU Glutamine synthetase (Gene Name=glnA)

[Back to BioLiP]