Structure of PDB 4s0h Chain E Binding Site BS01

Receptor Information

>4s0h Chain E (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYIL
LMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQL
VSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADTAFCTHVFPETAF
IAVTSYQNHKITQLKIENNPFAKGFRG

Ligand information

>4s0h Chain G (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctcacacctttgaagtgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4s0h Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.
Resolution	2.817 Å
Binding residue (original residue number in PDB)	N162 S175 T215 P231 K234 G235
Binding residue (residue number reindexed from 1)	N110 S123 T154 P170 K173 G174

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4s0h, PDBe:4s0h, PDBj:4s0h
PDBsum	4s0h
PubMed	26926761
UniProt	Q99593\|TBX5_HUMAN T-box transcription factor TBX5 (Gene Name=TBX5)

[Back to BioLiP]