Structure of PDB 4qvd Chain E Binding Site BS01

Receptor Information
>4qvd Chain E (length=60) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qvd Structural insights into the recognition of the internal A-rich linker from OxyS sRNA by Escherichia coli Hfq
Resolution1.972 Å
Binding residue
(original residue number in PDB)		I30 K31 L32 Q33 Q52
Binding residue
(residue number reindexed from 1)		I25 K26 L27 Q28 Q47
Binding affinityPDBbind-CN: Kd=1490nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4qvd, PDBe:4qvd, PDBj:4qvd
PDBsum4qvd
PubMed25670676
UniProtC1IFD2

[Back to BioLiP]